General Information

  • ID:  hor001900
  • Uniprot ID:  P01278
  • Protein name:  Glucagon-1
  • Gene name:  gcg1
  • Organism:  Lophius americanus (American angler) (Anglerfish)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lophius (genus), Lophiidae (family), Lophioidei (suborder), Lophiiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSEGTFSNDYSKYLEDRKAQEFVRWLMNN
  • Length:  29
  • Propeptide:  MKRIHSLAGILLVLGLIQSSCRVLMQEADPSSSLEADSTLKDEPRELSNMKRHSEGTFSNDYSKYLEDRKAQEFVRWLMNNKRSGVAEKRHADGTFTSDVSSYLKDQAIKDFVDRLKAGQVRRE
  • Signal peptide:  MKRIHSLAGILLVLGLIQSSCRVLM
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Glucagon plays a key role in glucose metabolism and homeostasis.
  • Mechanism:  Increase gluconeogenesis and decrease glycolysis.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01278-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001900_AF2.pdbhor001900_ESM.pdb

Physical Information

Mass: 406547 Formula: C157H230N44O50S
Absent amino acids: CIP Common amino acids: ENS
pI: 5.65 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 7
Hydrophobicity: -128.97 Boman Index: -9471
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 40.34
Instability Index: 5231.38 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  3058456
  • Title:  Pancreatic proglucagon processing: isolation and structures of glucagon and glucagon-like peptide from gene I